PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_5AL_09C375647.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family bZIP
Protein Properties Length: 76aa    MW: 9011.39 Da    PI: 11.1104
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_5AL_09C375647.1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_130.11.1e-09260563
                           CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                 bZIP_1  5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63
                           kr rr   NRe+Ar   +R++a  +eL++kv+ L+++N+++kke e+  +e+ +l+  +
  Traes_5AL_09C375647.1  2 KRLRRVLANRESARQTILRRQAIRDELARKVADLSSQNESMKKEKETAMQEYLTLQETN 60
                           99**************************************************9998766 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS502179.599163IPR004827Basic-leucine zipper domain
SMARTSM003384.6E-7162IPR004827Basic-leucine zipper domain
SuperFamilySSF579597.55E-8257No hitNo description
Gene3DG3DSA:1.20.5.1708.8E-6267No hitNo description
PfamPF001703.2E-8260IPR004827Basic-leucine zipper domain
CDDcd147026.68E-8353No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 76 aa     Download sequence    Send to blast
AKRLRRVLAN RESARQTILR RQAIRDELAR KVADLSSQNE SMKKEKETAM QEYLTLQETN  60
KQLKEQARHH LPLPLF
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015619098.19e-41PREDICTED: G-box-binding factor 1
TrEMBLW5EUG41e-47W5EUG4_WHEAT; Uncharacterized protein
STRINGBGIOSGA037021-PA3e-40(Oryza sativa Indica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP31653475
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G19490.12e-17bZIP family protein
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]